NBP1-93964 C19orf60 antibody

See related secondary antibodies

Search for all "C19orf60"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C19orf60

Product Description for C19orf60

Rabbit anti Human C19orf60.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C19orf60

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96EN9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE
GeneID:
55049
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55049

Accessory Products

Proteins and/or Positive Controls

Positive controls for C19orf60 (2 products)

Catalog No. Species Pres. Purity   Source  

C19orf60 overexpression lysate

C19orf60 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C19orf60 overexpression lysate

C19orf60 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn