H00284361-B01P C19orf63 antibody

See related secondary antibodies

Search for all "C19orf63"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C19orf63

H00284361-B01P

Product Description for C19orf63

Mouse anti Human C19orf63.
Product is tested for Western blot / Immunoblot.

Properties for C19orf63

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HSM1, HSS1, INM02, MGC33203
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5UCC4
Immunogen:
C19orf63 (AAH32948.1, 1 a.a. ~ 262 a.a) full-length human protein.
AA Sequence:
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLW NQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDV AGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWM YIIPVVLFLMMSGAPDAGGQGGGGGGGGGGGSGR
GeneID:
284361
Add. information Mouse polyclonal antibody raised against a full-length human C19orf63 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf63 (3 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag, transcript variant HSS1)

Chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 (transcript variant HSS1)

Chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Secreted form of human HSS1 with DDK/His tag, expressed in human cells, 20ug

Secreted form of human HSS1 with DDK/His tag, expressed in human cells, 20ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C19orf63 (1 products)

Catalog No. Species Pres. Purity   Source  

EMC10 overexpression lysate

EMC10 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn