H00027042-B01P C1orf107 antibody

See related secondary antibodies

Search for all "C1orf107"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf107

H00027042-B01P

Product Description for C1orf107

Mouse anti Human C1orf107.
Product is tested for Western blot / Immunoblot.

Properties for C1orf107

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DEF, DJ434O14.5, DKFZp686E19106, FLJ12704, FLJ41680, MGC29875
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68CQ4
Immunogen:
C1orf107 (NP_055203.4, 1 a.a. ~ 756 a.a) full-length human protein.
AA Sequence:
MGKRGSRSQSQLLNTLTKKQKKHLRDFGEEHPFYDRVSRKEAKPQICQLSESSDSSDSESDSESEPQQVSGYHRLL ATLKNVSEEEEEDEEEEEEEDSIVDDAEMNDEDGGSDVSVEEEMAAESTESPENVALSADPEGKEDGEEPPGTSQT SPEEFTDAKHESLFSLETNFLEEESGDNSSLKASQDPFLQHVNKELKEKAIQAVATNPKTTHELKWPILGQLFFSS KFQKLETFKPPKDIDLKSLHLQKPLESTWTKTNSQFLSGPQKSSSPFTPLQKELFLIMNSYRDLFYPERTALKNGE EIRHVYCLHVINHILKANAQVLGNNSRRRSQKFGVGDDDDFRDQGLTRPKVLIVVPFREAALRVVQLFISLLEGDS KKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGNIDDHFRIGVAILQRSIRLYAPFYSSDILIASPLGLR TIIGGEGEKKRDFDFLSSIELLIIDQADIYLMQNWEHVLHLMNHMNLLPLDSHGVDFSRVRMWSLNNWSKYYRQTL LFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRD AVMSHTLIYIPSYFDFVRLRNYFKKEELNFTHICEYTQKSGVSRARHFFLQGEKQFLLFTERFHFYKRYTIKGIRN LIFYELPTYPHFYSEICNMLRATNRGEEATWTCTVLYSKYDAQRLAAVVGVERAAQMLQSNKNVHLFITGEK
GeneID:
27042
Add. information Mouse polyclonal antibody raised against a full-length human C1orf107 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf107 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 107 (C1orf107)

Chromosome 1 open reading frame 107 (C1orf107) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for C1orf107 (2 products)

Catalog No. Species Pres. Purity   Source  

C1orf107 Lysate

Western Blot: C1orf107 Lysate [NBL1-08291] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf107 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

DIEXF overexpression lysate

DIEXF overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn