NBP1-82176 C1orf109 antibody

See related secondary antibodies

Search for all "C1orf109"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C1orf109

Product Description for C1orf109

Rabbit anti Human C1orf109.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C1orf109

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX04
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE
GeneID:
54955
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 54955

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf109 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 109 (C1orf109)

Chromosome 1 open reading frame 109 (C1orf109) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C1orf109 (2 products)

Catalog No. Species Pres. Purity   Source  

C1orf109 Lysate

Western Blot: C1orf109 Lysate [NBL1-08292] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf109 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C1orf109 overexpression lysate

C1orf109 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn