H00079762-B01P C1orf115 antibody

See related secondary antibodies

Search for all "C1orf115"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf115

H00079762-B01P

Product Description for C1orf115

Mouse anti Human C1orf115.
Product is tested for Western blot / Immunoblot.

Properties for C1orf115

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ14146, RP11-322F10.4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H7X2
Immunogen:
C1orf115 (NP_078985.3, 1 a.a. ~ 142 a.a) full-length human protein.
AA Sequence:
MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVHFALLPE RYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSFVR
GeneID:
79762
Add. information Mouse polyclonal antibody raised against a full-length human C1orf115 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf115 (2 products)

Catalog No. Species Pres. Purity   Source  

C1orf115 Lysate

Western Blot: C1orf115 Lysate [NBL1-08293] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf115 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C1orf115 overexpression lysate

C1orf115 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn