H00054987-B01P C1orf123 antibody

See related secondary antibodies

Search for all "C1orf123"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf123

H00054987-B01P

Product Description for C1orf123

Mouse anti Human C1orf123.
Product is tested for Western blot / Immunoblot.

Properties for C1orf123

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ20580
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWV4
Immunogen:
C1orf123 (NP_060357.1, 1 a.a. ~ 160 a.a) full-length human protein.
AA Sequence:
MGKIALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSI EILSSTIKPYNAEDNENFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYE VTHQFVKC
GeneID:
54987
Add. information Mouse polyclonal antibody raised against a full-length human C1orf123 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf123 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 123 (C1orf123)

Chromosome 1 open reading frame 123 (C1orf123) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C1orf123 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf123 Lysate

Western Blot: C1orf123 Lysate [NBL1-08294] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf123 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn