H00057095-B01P C1orf128 antibody

See related secondary antibodies

Search for all "C1orf128"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf128

H00057095-B01P

Product Description for C1orf128

Mouse anti Human C1orf128.
Product is tested for Western blot / Immunoblot.

Properties for C1orf128

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HT014, RP5-886K2.4, TXNL1CL
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZP4
Immunogen:
C1orf128 (NP_065095.2, 1 a.a. ~ 211 a.a) full-length human protein.
AA Sequence:
MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRSKFVESDADEEL LFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYATKISRFSNVYHL SIHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFIS
GeneID:
57095
Add. information Mouse polyclonal antibody raised against a full-length human C1orf128 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn