NBP1-93768 C1orf130 antibody

See related secondary antibodies

Search for all "C1orf130"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C1orf130

Product Description for C1orf130

Rabbit anti Human C1orf130.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C1orf130

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 400746

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf130 (1 products)

Catalog No. Species Pres. Purity   Source  

NCMAP overexpression lysate

NCMAP overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn