H00081626-B01P C1orf14 antibody

See related secondary antibodies

Search for all "C1orf14"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf14

H00081626-B01P

Product Description for C1orf14

Mouse anti Human C1orf14.
Product is tested for Western blot / Immunoblot.

Properties for C1orf14

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms GE36, MGC26911, MGC48296, SHCBP1L
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZQ2
Immunogen:
C1orf14 (NP_112195.2, 1 a.a. ~ 653 a.a) full-length human protein.
AA Sequence:
MASGSKASVPADSFRTISPDRRGEKSASAVSGDTAAATTLKGTAIPVRSVVASPRPVKGKAGRETARLRLQRLPAA QAEDTGEAAAAAAEEPLLPVPEDEEEAQPLPPVCVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLK LKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPFSSNIANIPRDLVDEILEELE HSVPLLEVYPVEGQDTDIHVIALALEVVRFFYDFLWRDWDDEESCENYTALIEERINLWCDIQDGTIPGPIAQRFK KTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCGLLKMWEDLRLRVHGPFFPRILRRRKGKREFGK TITHIVAKMMTTEMIKDLSSDTLLQQHGDLDLALDNCYSGDTVIIFPGEYQAANLALLTDDIIIKGVGKREEIMIT SEPSRDSFVVSKADNVKLMHLSLIQQGTVDGIVVVESGHMTLENCILKCEGTGVCVLTGAALTITDSEITGAQGAG VELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEA LNKRASSGDKKDDKMLFKVMQNLNLEMNNNKIEANVKGDIRIVTS
GeneID:
81626
Add. information Mouse polyclonal antibody raised against a full-length human C1orf14 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf14 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 14 (C1orf14)

Chromosome 1 open reading frame 14 (C1orf14) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C1orf14 (1 products)

Catalog No. Species Pres. Purity   Source  

SHCBP1L overexpression lysate

SHCBP1L overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn