H00128346-B01P C1orf162 antibody

See related secondary antibodies

Search for all "C1orf162"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf162

H00128346-B01P

Product Description for C1orf162

Mouse anti Human C1orf162.
Product is tested for Western blot / Immunoblot.

Properties for C1orf162

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC24133
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEQ5
Immunogen:
C1orf162 (NP_777556.1, 1 a.a. ~ 155 a.a) full-length human protein.
AA Sequence:
MGGNGSTCKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVLLTLLLIAFIFLIIKSYRKYRRERLPIS PGPLLRWVPLLSGTMADHSKPQAPDPHSDPPAKLSSIPGESLTYASTTFKLSEEKSNHLAENHSADFDPIVYAQIK VTN
GeneID:
128346
Add. information Mouse polyclonal antibody raised against a full-length human C1orf162 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf162 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf162 overexpression lysate

C1orf162 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn