NBP1-94077 C1orf173 antibody

See related secondary antibodies

Search for all "C1orf173"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C1orf173

Product Description for C1orf173

Rabbit anti Human C1orf173.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C1orf173

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RHP9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DTGPMEDTASKREDGSEEAILGGEEPAKERKEVMRTETRLSPFTGEAEASRMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEILPKE
GeneID:
127254
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 127254

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf173 (1 products)

Catalog No. Species Pres. Purity   Source  

ERICH3 overexpression lysate

ERICH3 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn