H00054953-B01P C1orf27 antibody

See related secondary antibodies

Search for all "C1orf27"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf27

H00054953-B01P

Product Description for C1orf27

Mouse anti Human C1orf27.
Product is tested for Western blot / Immunoblot.

Properties for C1orf27

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ20505, TTG1, odr-4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SWX8
Immunogen:
C1orf27 (NP_060317.3, 1 a.a. ~ 454 a.a) full-length human protein.
AA Sequence:
MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHPKAKLDNLDEEWATEHA CQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSINRKRLWNFTEEEVSERVTLHICASTKKIFCRTY DIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKD EDCDLLEGQKKSSRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKDAVQA VKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDH TIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIKTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD
GeneID:
54953
Add. information Mouse polyclonal antibody raised against a full-length human C1orf27 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf27 (3 products)

Catalog No. Species Pres. Purity   Source  

C1orf27 Lysate

Western Blot: C1orf27 Lysate [NBL1-08317] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf27 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C1orf27 overexpression lysate

C1orf27 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C1orf27 overexpression lysate

C1orf27 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn