H00010485-B01P C1orf61 antibody

See related secondary antibodies

Search for all "C1orf61"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf61

H00010485-B01P

Product Description for C1orf61

Mouse anti Human C1orf61.
Product is tested for Western blot / Immunoblot.

Properties for C1orf61

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CROC4, FLJ38303
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13536
Immunogen:
C1orf61 (AAI56769.1, 1 a.a. ~ 156 a.a) full-length human protein.
AA Sequence:
MFLTEDLITFNLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSSPRPPGSTSHCGISTRC TERCLCVLPLRTSQVPDVMAPQHDQEKFHDLAYSCLGKSFSMSNQDLYGYSTSSLALGLAWLSWETKKKNVLHLVG LDSL
GeneID:
10485
Add. information Mouse polyclonal antibody raised against a full-length human C1orf61 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf61 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 61 (C1orf61), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 1 open reading frame 61 (C1orf61), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.
  • LinkedIn