H00163882-B01P C1orf71 antibody

See related secondary antibodies

Search for all "C1orf71"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf71

H00163882-B01P

Product Description for C1orf71

Mouse anti Human C1orf71.
Product is tested for Western blot / Immunoblot.

Properties for C1orf71

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ32001, MGC18089
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PJW8
Immunogen:
C1orf71 (AAH36200.1, 1 a.a. ~ 263 a.a) full-length human protein.
AA Sequence:
MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLNNNESCT LSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEKVLSAVTYAVDDE EAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLS AIQEQWGKYRPTWNVELAVIQQVTIYKINIFDLVL
GeneID:
163882
Add. information Mouse polyclonal antibody raised against a full-length human C1orf71 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn