H00128344-B01P C1orf88 antibody

See related secondary antibodies

Search for all "C1orf88"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1orf88

H00128344-B01P

Product Description for C1orf88

Mouse anti Human C1orf88.
Product is tested for Western blot / Immunoblot.

Properties for C1orf88

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ23853, MGC126550
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TCI5
Immunogen:
C1orf88 (NP_857594.1, 1 a.a. ~ 191 a.a) full-length human protein.
AA Sequence:
MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYDLSKIPTSIKGYTLGAR TAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFKNYPKDTYYPSPGAYNPEKKPPPKIAWPMKFGS PDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN
GeneID:
128344
Add. information Mouse polyclonal antibody raised against a full-length human C1orf88 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn