H00389941-B01P C1QL3 antibody

See related secondary antibodies

Search for all "C1QL3"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C1QL3

H00389941-B01P

Product Description for C1QL3

Mouse anti Human C1QL3.
Product is tested for Western blot / Immunoblot.

Properties for C1QL3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C1ql, K100
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VWW1
Immunogen:
C1QL3 (AAI60038.1, 1 a.a. ~ 255 a.a) full-length human protein.
AA Sequence:
MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRG PPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNL GNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVY IKLDGGKAHGGNNNKYSTFSGFIIYAD
GeneID:
389941
Add. information Mouse polyclonal antibody raised against a full-length human C1QL3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C1QL3 (1 products)

Catalog No. Species Pres. Purity   Source  

Complement component 1, q subcomponent-like 3 (C1QL3)

Complement component 1, q subcomponent-like 3 (C1QL3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn