discontinued

H00114898-D01P C1QTNF2 antibody

See related secondary antibodies

Search for all "C1QTNF2"

Quick Overview

Rabbit anti Human C1QTNF2

Product Description for C1QTNF2

Rabbit anti Human C1QTNF2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for C1QTNF2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CTRP2, Complement C1q tumor necrosis factor-related protein 2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXJ5
Immunogen:
C1QTNF2 (AAH11699.1, 1 a.a. ~ 285 a.a) full-length human protein.
AA Sequence:
MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRG DSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAF SVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTG NHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV
GeneID:
114898
Remarks:
Gene Accession: BC011699.2
Add. information Rabbit polyclonal antibody raised against a full-length human C1QTNF2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 114898

Accessory Products

Proteins and/or Positive Controls

Proteins for C1QTNF2 (3 products)

Catalog No. Species Pres. Purity   Source  

C1QTNF2

C1QTNF2 Human
  Abnova Taiwan Corp.

C1QTNF2

C1QTNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C1QTNF2

C1QTNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for C1QTNF2 (4 products)

Catalog No. Species Pres. Purity   Source  

C1QTNF2 293T Cell Transient Overexpression Lysate(Denatured)

C1QTNF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C1QTNF2 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

C1QTNF2 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-C1QTNF2 antibody (H00114898-M01) by Western Blots.
  Abnova Taiwan Corp.

C1QTNF2 overexpression lysate

C1QTNF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CTRP2 Lysate

Western Blot: CTRP2 Lysate [NBL1-08343] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1QTNF2 Protein
  Novus Biologicals Inc.
  • LinkedIn