discontinued

NBP1-90563 C20orf151 antibody

See related secondary antibodies

Search for all "C20orf151"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C20orf151

Product Description for C20orf151

Rabbit anti Human C20orf151.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C20orf151

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NC74
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH
GeneID:
140893
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 140893

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf151 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 20 open reading frame 151 (C20orf151)

Chromosome 20 open reading frame 151 (C20orf151) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn