discontinued

H00079025-B01P C20orf195 antibody

See related secondary antibodies

Search for all "C20orf195"

Quick Overview

Mouse anti Human C20orf195

Product Description for C20orf195

Mouse anti Human C20orf195.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for C20orf195

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Uncharacterized protein C20orf195
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BVV2
Immunogen:
C20orf195 (NP_076964.1, 1 a.a. ~ 318 a.a) full-length human protein.
AA Sequence:
MSTHVAGLGLDKMKLGNPQSFLDQEEADDQQLLEPEAWKTYTERRNALREFLTSDLSPHLLKRHHARMQLLRKCSY YIEVLPKHLALGDQNPLVLPSALFQLIDPWKFQRMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPF LADWALVERRLADVSAVMDSFLTMMVPGRLHVKHRLVSDVSATKIPHIWLMLSTKMPVVFDRKASAAHQDWARLRW FVTIQPATSEQYELRFRLLDPRTQQECAQCGVIPVAACTFDVRNLLPNRSYKFTIKRAETSTLVYEPWRDSLTLHT KPEPLEGPALSHSV
GeneID:
79025
Remarks:
Gene Accession: NM_024059
Add. information Mouse polyclonal antibody raised against a full-length human C20orf195 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79025

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf195 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf195

C20orf195 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C20orf195 (3 products)

Catalog No. Species Pres. Purity   Source  

C20orf195 293T Cell Transient Overexpression Lysate(Denatured)

C20orf195 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C20orf195 Lysate

Western Blot: C20orf195 Lysate [NBL1-08366] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C20orf195 Protein
  Novus Biologicals Inc.

C20orf195 overexpression lysate

C20orf195 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn