NBP1-90964 C20orf202 antibody

See related secondary antibodies

Search for all "C20orf202"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C20orf202

Product Description for C20orf202

Rabbit anti Human C20orf202.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C20orf202

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L168
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHL
GeneID:
400831
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 400831

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf202 (1 products)

Catalog No. Species Pres. Purity   Source  

Hypothetical LOC400831 (LOC400831)

Hypothetical LOC400831 (LOC400831) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C20orf202 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf202 overexpression lysate

C20orf202 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn