NBP1-94038 C20orf46 antibody

See related secondary antibodies

Search for all "C20orf46"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C20orf46

Product Description for C20orf46

Rabbit anti Human C20orf46.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C20orf46

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUR3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVS
GeneID:
55321
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55321

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf46 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 20 open reading frame 46 (C20orf46)

Chromosome 20 open reading frame 46 (C20orf46) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C20orf46 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM74B overexpression lysate

TMEM74B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn