NBP1-93543 C2orf79 antibody

See related secondary antibodies

Search for all "C2orf79"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C2orf79

Product Description for C2orf79

Rabbit anti Human C2orf79.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C2orf79

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6GMV3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
GeneID:
391356
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 391356

Accessory Products

Proteins and/or Positive Controls

Proteins for C2orf79 (3 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 2 open reading frame 79 (C2orf79)

Chromosome 2 open reading frame 79 (C2orf79) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

PTRHD1 (1-140, His-tag)

PTRHD1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

PTRHD1 (1-140, His-tag)

PTRHD1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Positive controls for C2orf79 (1 products)

Catalog No. Species Pres. Purity   Source  

PTRHD1 overexpression lysate

PTRHD1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn