discontinued

NBP1-93543 C2orf79 antibody

See related secondary antibodies

Search for all "C2orf79"

Quick Overview

Rabbit anti Human C2orf79

Product Description for C2orf79

Rabbit anti Human C2orf79.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C2orf79

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6GMV3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
GeneID:
391356
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 391356

Accessory Products

Proteins and/or Positive Controls

Proteins for C2orf79 (3 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 2 open reading frame 79 (C2orf79)

Chromosome 2 open reading frame 79 (C2orf79) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

PTRHD1 (1-140, His-tag)

PTRHD1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

PTRHD1 (1-140, His-tag)

PTRHD1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Positive controls for C2orf79 (1 products)

Catalog No. Species Pres. Purity   Source  

PTRHD1 overexpression lysate

PTRHD1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn