
NBP1-59919 C3orf17 antibody

See related secondary antibodies

Search for all "C3orf17"

50 µg / €440.00

Quick Overview

Rabbit anti Human C3orf17

Product Description for C3orf17

Rabbit anti Human C3orf17.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for C3orf17

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS.
Background The function of the C3orf17 protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 25871

Accessory Products

  • LinkedIn