H00152065-B01P C3orf22 antibody

See related secondary antibodies

Search for all "C3orf22"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C3orf22

H00152065-B01P

Product Description for C3orf22

Mouse anti Human C3orf22.
Product is tested for Western blot / Immunoblot.

Properties for C3orf22

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC34728
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5N4
Immunogen:
C3orf22 (NP_689746.1, 1 a.a. ~ 141 a.a) full-length human protein.
AA Sequence:
MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAP DFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS
GeneID:
152065
Add. information Mouse polyclonal antibody raised against a full-length human C3orf22 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C3orf22 (2 products)

Catalog No. Species Pres. Purity   Source  

C3orf22 Lysate

Western Blot: C3orf22 Lysate [NBL1-08438] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C3orf22 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C3orf22 overexpression lysate

C3orf22 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn