H00285343-B01P C3orf23 antibody

See related secondary antibodies

Search for all "C3orf23"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C3orf23

H00285343-B01P

Product Description for C3orf23

Mouse anti Human C3orf23.
Product is tested for Western blot / Immunoblot.

Properties for C3orf23

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp313N0621, FLJ41686, MGC119530, MGC119531, MGC119532, MGC119533
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N3R3
Immunogen:
C3orf23 (CAL38235.1, 1 a.a. ~ 496 a.a) full-length human protein.
AA Sequence:
MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVEREINENSLKRLSVYLENLQKPG FKSLKPTQLTFYVRETDQSSSDGQEPFSTSGFRAVKFTLHTRDLLSTVLYILNSCSLSVEHIQSLNTNMHTQPLKE AKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLPLRKELDRLKDELSHQLQL SDIRWQRSWGIAHRCGQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVGHVMLGTMDVHHHWTKLFERLPSYF DLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYNRLLKSRILFHPRSLRGLQMILNSDRYAPSL HELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKVIENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRL LEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWKNGEAIK
GeneID:
285343
Add. information Mouse polyclonal antibody raised against a full-length human C3orf23 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C3orf23 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 3 open reading frame 23 (C3orf23), transcript variant 1 (transcript variant 1)

Chromosome 3 open reading frame 23 (C3orf23), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn