H00090288-B01P C3orf25 antibody

See related secondary antibodies

Search for all "C3orf25"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C3orf25

H00090288-B01P

Product Description for C3orf25

Mouse anti Human C3orf25.
Product is tested for Western blot / Immunoblot.

Properties for C3orf25

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NXP0
Immunogen:
C3orf25 (NP_997190.1, 1 a.a. ~ 572 a.a) full-length human protein.
AA Sequence:
MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPEPVIAHCFKQFQQKDFRLPQTRRRIIMVPRKEDQTPLNPASQ PQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPN ASQATTRTTRKKAPRLSRLSRQMVPQLQLPEPPALSVMYSYLHSRKIKILEIFHKVGQGENQRITREEFIAAVKAV GVPLKNQEVEDIVIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATAREHYILAKHRDSLKGPLKKQEVDSAPQ LPKVDLLTVPAVDTQMETRPMTLEEMEEVGKRYRERQRQHKLTIPSIQYTEQCHLVRCGNRHFDEHCLPSTIHGDM RELIDSARRHNFLVYLQCWKLCKSYGLPLTEDILMKALLYPGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLR SQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSC VQHQPHVYPATYHPDHWWPLRNKNYMTHAHYDAAKVYYIN
GeneID:
90288
Add. information Mouse polyclonal antibody raised against a full-length human C3orf25 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C3orf25 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 3 open reading frame 25 (C3orf25), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 3 open reading frame 25 (C3orf25), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C3orf25 (2 products)

Catalog No. Species Pres. Purity   Source  

C3orf25 Lysate

Western Blot: C3orf25 Lysate [NBL1-08440] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C3orf25 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

EFCAB12 overexpression lysate

EFCAB12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn