H00054859-B01P C3orf75 antibody

See related secondary antibodies

Search for all "C3orf75"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C3orf75

H00054859-B01P

Product Description for C3orf75

Mouse anti Human C3orf75.
Product is tested for Western blot / Immunoblot.

Properties for C3orf75

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ20211, TMEM103
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0PNE2
Immunogen:
C3orf75 (AAH00623.1, 1 a.a. ~ 268 a.a) full-length human protein.
AA Sequence:
MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYSIVGQKLGVSLTMAR ERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLREANAGNLKPLFEFVREALKPVDSGEARWTYPVLLVDDLSVLLSL GMGAVAVLDFIHYCRATVCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRIL WRRPSQPAVHRDQSFTYQYKIQDKSVSFFCQRNVSCCSVT
GeneID:
54859
Add. information Mouse polyclonal antibody raised against a full-length human C3orf75 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C3orf75 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 3 open reading frame 75 (C3orf75)

Chromosome 3 open reading frame 75 (C3orf75) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C3orf75 (2 products)

Catalog No. Species Pres. Purity   Source  

C3orf75 Lysate

Western Blot: C3orf75 Lysate [NBL1-16992] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C3orf75
0.1 mg / €400.00
  Novus Biologicals Inc.

ELP6 overexpression lysate

ELP6 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn