discontinued

H00432395-A01 C4B antibody

See related secondary antibodies

Search for all "C4B"

50 µl / €290.00

Quick Overview

Mouse anti Human C4B

H00432395-A01

Product Description for C4B

Mouse anti Human C4B.
Presentation: Serum
Product is tested for Western blot / Immunoblot.

Properties for C4B

Product Category Primary Antibodies
Quantity 50 µl
Presentation Serum
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
C4B (-, 774 a.a. ~ 874 a.a) partial recombinant protein with GST tag.
AA Sequence:
VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQL ELRPVLYNYLDKNLTVSVHVSPVE*
Remarks:
Gene Accession: NG_004658
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
State:
Serum

Accessory Products

  • LinkedIn