H00064417-B01P C5orf28 antibody

See related secondary antibodies

Search for all "C5orf28"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C5orf28

H00064417-B01P

Product Description for C5orf28

Mouse anti Human C5orf28.
Product is tested for Western blot / Immunoblot.

Properties for C5orf28

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ21657, MGC149524, MGC90226
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0VDI3
Immunogen:
C5orf28 (NP_071928.2, 1 a.a. ~ 215 a.a) full-length human protein.
AA Sequence:
MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVIGMWSWAVVTGIKKKTD FGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTVIPVVVLTLKFTMHLFKLKDSWCFLPWMLFISW TSHHIRDGIRHGLWICPFGKTSPLPFWLYVIITSSLPHICSFVMYLTGTRQMMSSKHGVRIDV
GeneID:
64417
Add. information Mouse polyclonal antibody raised against a full-length human C5orf28 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn