H00090355-B01P C5orf30 antibody

See related secondary antibodies

Search for all "C5orf30"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C5orf30

H00090355-B01P

Product Description for C5orf30

Mouse anti Human C5orf30.
Product is tested for Western blot / Immunoblot.

Properties for C5orf30

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ25291
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GV9
Immunogen:
C5orf30 (NP_149988.1, 1 a.a. ~ 206 a.a) full-length human protein.
AA Sequence:
MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQK CTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGP LPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT
GeneID:
90355
Add. information Mouse polyclonal antibody raised against a full-length human C5orf30 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C5orf30 (1 products)

Catalog No. Species Pres. Purity   Source  

C5orf30 Lysate

Western Blot: C5orf30 Lysate [NBL1-08490] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C5orf30 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn