NBP1-94023 C5orf42 antibody

See related secondary antibodies

Search for all "C5orf42"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C5orf42

Product Description for C5orf42

Rabbit anti Human C5orf42.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C5orf42

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4PXW2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IAENIEQDFPKPEMLDLHCDKIGPVDHIEFSSGPEFKKTLASKTISISEEVRFLTHMDEEDQSDKKETSEPEFSITE
GeneID:
6525000
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 6525000

Accessory Products

  • LinkedIn