H00085411-B01P C6orf114 antibody

See related secondary antibodies

Search for all "C6orf114"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C6orf114

H00085411-B01P

Product Description for C6orf114

Mouse anti Human C6orf114.
Product is tested for Western blot / Immunoblot.

Properties for C6orf114

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms ADG-90, FLJ20330, RP11-501I19.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JD4
Immunogen:
C6orf114 (NP_149060.1, 1 a.a. ~ 136 a.a) full-length human protein.
AA Sequence:
MGDSRRDVLHEPAIALLSSPQTQSRLQIDAFIARRCWGSQWDITGYIHQQDFPTAVFIGFSNEFNICIPHPFTEWL QCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWSET
GeneID:
54438
Add. information Mouse polyclonal antibody raised against a full-length human C6orf114 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf114 (1 products)

Catalog No. Species Pres. Purity   Source  

C6orf114 Lysate

Western Blot: C6orf114 Lysate [NBL1-08507] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for C6orf114. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn