NBP1-86260 C6orf114 antibody

See related secondary antibodies

Search for all "C6orf114"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C6orf114

Product Description for C6orf114

Rabbit anti Human C6orf114.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf114

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JD4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EWLQCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWCET
GeneID:
54438
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 85411

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf114 (1 products)

Catalog No. Species Pres. Purity   Source  

C6orf114 Lysate

Western Blot: C6orf114 Lysate [NBL1-08507] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for C6orf114. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn