H00029113-B01P C6orf15 antibody

See related secondary antibodies

Search for all "C6orf15"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C6orf15

H00029113-B01P

Product Description for C6orf15

Mouse anti Human C6orf15.
Product is tested for Western blot / Immunoblot.

Properties for C6orf15

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms STG
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXA7
Immunogen:
C6orf15 (AAI53158.1, 1 a.a. ~ 325 a.a) full-length human protein.
AA Sequence:
MQGRVAGSCAPLGLLLVCLHLPGLFARSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVP LKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLP GESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWG TRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPP GSSWNIPAGFPNPPSPRLQWG
GeneID:
29113
Add. information Mouse polyclonal antibody raised against a full-length human C6orf15 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn