H00088745-B01P C6orf153 antibody

See related secondary antibodies

Search for all "C6orf153"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C6orf153

H00088745-B01P

Product Description for C6orf153

Mouse anti Human C6orf153.
Product is tested for Western blot / Immunoblot.

Properties for C6orf153

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms dJ20C7.4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96EU6
Immunogen:
C6orf153 (NP_149103.1, 1 a.a. ~ 259 a.a) full-length human protein.
AA Sequence:
MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKK QASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELV KKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKE LKRSKKLENFLSRKRRRNAGKDRRHLPLSKE
GeneID:
88745
Add. information Mouse polyclonal antibody raised against a full-length human C6orf153 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf153 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf153 Lysate

Western Blot: C6orf153 Lysate [NBL1-08517] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf153 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

RRP36 overexpression lysate

RRP36 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn