discontinued

NBP1-84249 C6orf162 antibody

See related secondary antibodies

Search for all "C6orf162"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C6orf162

Product Description for C6orf162

Rabbit anti Human C6orf162.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf162

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KF7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP
GeneID:
57150
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 57150

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf162 (4 products)

Catalog No. Species Pres. Purity   Source  

C6orf162 Lysate

Western Blot: C6orf162 Lysate [NBL1-08519] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf162 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn