NBP1-84249 C6orf162 antibody

See related secondary antibodies

Search for all "C6orf162"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C6orf162

Product Description for C6orf162

Rabbit anti Human C6orf162.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf162

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KF7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP
GeneID:
57150
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 57150

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf162 (4 products)

Catalog No. Species Pres. Purity   Source  

C6orf162 Lysate

Western Blot: C6orf162 Lysate [NBL1-08519] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf162 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

SMIM8 overexpression lysate

SMIM8 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn