H00154288-B01P C6orf221 antibody

See related secondary antibodies

Search for all "C6orf221"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C6orf221

H00154288-B01P

Product Description for C6orf221

Mouse anti Human C6orf221.
Product is tested for Western blot / Immunoblot.

Properties for C6orf221

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms ECAT1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q587J8
Immunogen:
C6orf221 (ADR83511.1, 1 a.a. ~ 217 a.a) full-length human protein.
AA Sequence:
MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHV NRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVR EAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL
GeneID:
154288
Add. information Mouse polyclonal antibody raised against a full-length human C6orf221 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf221 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 6 open reading frame 221 (C6orf221)

Chromosome 6 open reading frame 221 (C6orf221) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C6orf221 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf221 Lysate

Western Blot: C6orf221 Lysate [NBL1-08528] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf221
0.1 mg / €400.00
  Novus Biologicals Inc.

KHDC3L overexpression lysate

KHDC3L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn