NBP1-91737 C6orf221 antibody

See related secondary antibodies

Search for all "C6orf221"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C6orf221

Product Description for C6orf221

Rabbit anti Human C6orf221.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf221

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q587J8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL
GeneID:
154288
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 154288

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf221 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 6 open reading frame 221 (C6orf221)

Chromosome 6 open reading frame 221 (C6orf221) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C6orf221 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf221 Lysate

Western Blot: C6orf221 Lysate [NBL1-08528] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf221
0.1 mg / €400.00
  Novus Biologicals Inc.

KHDC3L overexpression lysate

KHDC3L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn