discontinued

NBP1-84138 C6orf225 antibody

See related secondary antibodies

Search for all "C6orf225"

Quick Overview

Rabbit anti Human C6orf225

Product Description for C6orf225

Rabbit anti Human C6orf225.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf225

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4G0N7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK
GeneID:
619208
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 619208

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf225 (3 products)

Catalog No. Species Pres. Purity   Source  

C6orf225

C6orf225 Human
  Abnova Taiwan Corp.

C6orf225

C6orf225 Human
  Abnova Taiwan Corp.

Chromosome 6 open reading frame 225 (C6orf225)

Chromosome 6 open reading frame 225 (C6orf225) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C6orf225 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf225 Lysate

Western Blot: C6orf225 Lysate [NBL1-12622] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf225
  Novus Biologicals Inc.

FAM229B overexpression lysate

FAM229B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn