NBP1-84138 C6orf225 antibody

See related secondary antibodies

Search for all "C6orf225"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C6orf225

Product Description for C6orf225

Rabbit anti Human C6orf225.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C6orf225

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4G0N7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK
GeneID:
619208
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 619208

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf225 (3 products)

Catalog No. Species Pres. Purity   Source  

C6orf225

C6orf225 Human
10 µg / €380.00
  Abnova Taiwan Corp.

C6orf225

C6orf225 Human
25 µg / €510.00
  Abnova Taiwan Corp.

Chromosome 6 open reading frame 225 (C6orf225)

Chromosome 6 open reading frame 225 (C6orf225) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C6orf225 (2 products)

Catalog No. Species Pres. Purity   Source  

C6orf225 Lysate

Western Blot: C6orf225 Lysate [NBL1-12622] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf225
0.1 mg / €400.00
  Novus Biologicals Inc.

FAM229B overexpression lysate

FAM229B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn