
NBP1-69388 C6orf25 antibody

See related secondary antibodies

Search for all "C6orf25"

Quick Overview

Rabbit anti Human C6orf25

Product Description for C6orf25

Rabbit anti Human C6orf25.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for C6orf25

Product Category Primary Antibodies
Quantity 50 µg
Synonyms G6b, MGC142279, MGC142281, NG31
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to C6ORF25 The peptide sequence was selected from the N terminal of C6ORF25. Peptide sequence AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP.
Background The exact function of C6orf25 remains unknown.This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn