H00081688-B01P C6orf62 antibody

See related secondary antibodies

Search for all "C6orf62"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C6orf62

H00081688-B01P

Product Description for C6orf62

Mouse anti Human C6orf62.
Product is tested for Western blot / Immunoblot.

Properties for C6orf62

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp564G182, FLJ12619, Nbla00237, XTP12, dJ30M3.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZU0
Immunogen:
C6orf62 (NP_112201.1, 1 a.a. ~ 229 a.a) full-length human protein.
AA Sequence:
MGDPNSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDSSY SLESSLELLQKDVVQLHAPRYQSMRRDVIGCTQEMDFILWPRNDIEKIVCLLFSRWKESDEPFRPVQAKFEFHHGD YEKQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQLTHWAVGTIEDHLRPYMP E
GeneID:
81688
Add. information Mouse polyclonal antibody raised against a full-length human C6orf62 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf62 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 6 open reading frame 62 (C6orf62)

Chromosome 6 open reading frame 62 (C6orf62) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn