discontinued

H00079783-B01P C7orf10 antibody

See related secondary antibodies

Search for all "C7orf10"

Quick Overview

Mouse anti Human C7orf10

Product Description for C7orf10

Mouse anti Human C7orf10.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for C7orf10

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CaiB/baiF CoA-transferase family protein C7orf10, DERP13, Dermal papilla-derived protein 13, chromosome 7 open reading frame 10
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAC7
Immunogen:
C7orf10 (AAH98318.1, 1 a.a. ~ 471 a.a) full-length human protein.
AA Sequence:
MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLGDLGAEV IKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENYVPGKLSAMGLGY EDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAMTDLATGLYAYGAIMAGLI QKYKTGKGLFIDCNLLSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFATVCKI LDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNMKNVFAEPQNAVSGFQSLL HSLAHGPFLHLQGSARVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILKEVLRYDDRAI GELLSAGVVDQHETH
GeneID:
79783
Remarks:
Gene Accession: BC098318.1
Add. information Mouse polyclonal antibody raised against a full-length human C7orf10 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79783

Accessory Products

Proteins and/or Positive Controls

Proteins for C7orf10 (4 products)

Catalog No. Species Pres. Purity   Source  

C7orf10

C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C7orf10

C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C7orf10

C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C7orf10

C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for C7orf10 (2 products)

Catalog No. Species Pres. Purity   Source  

C7orf10 293T Cell Transient Overexpression Lysate(Denatured)

C7orf10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SUGCT overexpression lysate

SUGCT overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn