TA343225 C7orf10 antibody

Rabbit Polyclonal Anti-C7orf10 Antibody

See related secondary antibodies

Search for all "C7orf10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish C7orf10

Product Description for C7orf10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish C7orf10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C7orf10

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CaiB/baiF CoA-transferase family protein C7orf10, DERP13, Dermal papilla-derived protein 13, chromosome 7 open reading frame 10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-C7orf10 antibody is: synthetic peptide directed towards the N-terminal region of Human C7orf10. Synthetic peptide located within the following region: LSVNRNKKSIAVNIKDPKGVKIIYCSITGYGQTGPISQRAGYDAVASAVS.
Application WB
Background This gene encodes a protein that is similar to members of the CaiB/baiF CoA-transferase protein family. Mutations in this gene are associated with glutaric aciduria type III. Alterte splicing results in multiple transcript variants.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 985% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for C7orf10 (4 products)

Catalog No. Species Pres. Purity   Source  


C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


C7orf10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for C7orf10 (2 products)

Catalog No. Species Pres. Purity   Source  

C7orf10 293T Cell Transient Overexpression Lysate(Denatured)

C7orf10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SUGCT overexpression lysate

SUGCT overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn