H00079020-B01P C7orf25 antibody

See related secondary antibodies

Search for all "C7orf25"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C7orf25

H00079020-B01P

Product Description for C7orf25

Mouse anti Human C7orf25.
Product is tested for Western blot / Immunoblot.

Properties for C7orf25

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ21167, MGC2821
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BPX7
Immunogen:
C7orf25 (AAH00769.1, 1 a.a. ~ 421 a.a) full-length human protein.
AA Sequence:
MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIV ESAENLEEVVSVLHVFGYTDTLGEKQTLVVDVVANGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQA SHQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNALLDHPEELQPSESESDDEGPELLQVTRVDRE NILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFAC ESAVKDFQSILDTLGGPGERERATVLIKRINVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFV RAANNQGVKFSVFIHQPRALTESKEALATPLPKDYTTDSEH
GeneID:
79020
Add. information Mouse polyclonal antibody raised against a full-length human C7orf25 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C7orf25 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 7 open reading frame 25 (C7orf25), transcript variant 2 (transcript variant 2)

Chromosome 7 open reading frame 25 (C7orf25), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C7orf25 (3 products)

Catalog No. Species Pres. Purity   Source  

C7orf25 Lysate

Western Blot: C7orf25 Lysate [NBL1-08547] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C7orf25
0.1 mg / €400.00
  Novus Biologicals Inc.

C7orf25 overexpression lysate

C7orf25 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C7orf25 overexpression lysate

C7orf25 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn