discontinued

NBP1-90611 C7orf34 antibody

See related secondary antibodies

Search for all "C7orf34"

Quick Overview

Rabbit anti Human C7orf34

Product Description for C7orf34

Rabbit anti Human C7orf34.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C7orf34

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96L11
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASV
GeneID:
135927
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 135927

Accessory Products

Proteins and/or Positive Controls

Positive controls for C7orf34 (1 products)

Catalog No. Species Pres. Purity   Source  

C7orf34 overexpression lysate

C7orf34 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn