H00136263-B01P C7orf45 antibody

See related secondary antibodies

Search for all "C7orf45"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C7orf45

H00136263-B01P

Product Description for C7orf45

Mouse anti Human C7orf45.
Product is tested for Western blot / Immunoblot.

Properties for C7orf45

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ40316
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WWF3
Immunogen:
C7orf45 (NP_660311.1, 1 a.a. ~ 244 a.a) full-length human protein.
AA Sequence:
MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASVWMSEDKKDEGSGTSTS VRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALVNAYPEQRRARRQSQFNEVNQNQHDSDTTEYGS EESNSEASSWKESESEHHPSPDSIKRRKMAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDS QEESSISDINKKFSKF
GeneID:
136263
Add. information Mouse polyclonal antibody raised against a full-length human C7orf45 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C7orf45 (1 products)

Catalog No. Species Pres. Purity   Source  

C7orf45 Lysate

Western Blot: C7orf45 Lysate [NBL1-08557] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C7orf45
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn