NBP1-81923 C7orf53 antibody

See related secondary antibodies

Search for all "C7orf53"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C7orf53

NBP1-81923

More Views

  • NBP1-81923

Product Description for C7orf53

Rabbit anti Human C7orf53.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for C7orf53

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8F7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRS
GeneID:
286006
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 286006

Accessory Products

Proteins and/or Positive Controls

Proteins for C7orf53 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 (transcript variant 1)

Chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 (transcript variant 2)

Chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C7orf53 (3 products)

Catalog No. Species Pres. Purity   Source  

C7orf53 Lysate

Western Blot: C7orf53 Lysate [NBL1-08560] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C7orf53
0.1 mg / €400.00
  Novus Biologicals Inc.

LSMEM1 overexpression lysate

LSMEM1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

LSMEM1 overexpression lysate

LSMEM1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn