H00157657-B01P C8orf37 antibody

See related secondary antibodies

Search for all "C8orf37"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C8orf37

H00157657-B01P

Product Description for C8orf37

Mouse anti Human C8orf37.
Product is tested for Western blot / Immunoblot.

Properties for C8orf37

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ30600
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NL8
Immunogen:
C8orf37 (NP_808880.1, 1 a.a. ~ 207 a.a) full-length human protein.
AA Sequence:
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNL DKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCD YLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH
GeneID:
157657
Add. information Mouse polyclonal antibody raised against a full-length human C8orf37 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn