NBP1-89554 C8orf40 antibody

See related secondary antibodies

Search for all "C8orf40"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C8orf40

NBP1-89554

More Views

  • NBP1-89554
  • NBP1-89554

Product Description for C8orf40

Rabbit anti Human C8orf40.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for C8orf40

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96E16
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRNKRRIMRIFSVPPTEETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE
GeneID:
114926
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 114926

Accessory Products

Proteins and/or Positive Controls

Proteins for C8orf40 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 8 open reading frame 40 (C8orf40), transcript variant 3 (transcript variant 3)

Chromosome 8 open reading frame 40 (C8orf40), transcript variant 3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C8orf40 (2 products)

Catalog No. Species Pres. Purity   Source  

C8orf40 Lysate

Western Blot: C8orf40 Lysate [NBL1-08568] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C8orf40
0.1 mg / €400.00
  Novus Biologicals Inc.

SMIM19 overexpression lysate

SMIM19 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn