H00541565-B01P C8orf58 antibody

See related secondary antibodies

Search for all "C8orf58"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C8orf58

H00541565-B01P

Product Description for C8orf58

Mouse anti Human C8orf58.
Product is tested for Western blot / Immunoblot.

Properties for C8orf58

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ34715
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NAV2
Immunogen:
C8orf58 (NP_001013864.1, 1 a.a. ~ 365 a.a) full-length human protein.
AA Sequence:
MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSGVEMAVG DSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLERSRRLPTAPTSLSGQHRSLRLASKPEREVPLGA GQQESMEADTDLEAGLEEEAVGGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYLQLRIQRPPGDPGEEESTR APLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPVEPTYHLPSSQGHKRDISHWDKVKV LLNRICRRSHHHPEPPAPPDGSDPRIESRDLPERPQCRPHRKTFMPSLVVKKQRAKNLSVG
GeneID:
541565
Add. information Mouse polyclonal antibody raised against a full-length human C8orf58 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C8orf58 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 8 open reading frame 58 (C8orf58)

Chromosome 8 open reading frame 58 (C8orf58) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C8orf58 (2 products)

Catalog No. Species Pres. Purity   Source  

C8orf58 overexpression lysate

C8orf58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C8orf58 overexpression lysate

C8orf58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn